- Log in
- Browse Businesses
- Guides
- Resources
- Write a Review
- Request a Review
- Backed by the National Science Foundation
- For Business
Records Finder has a rating of 3.8 stars from 7,829 reviews, indicating that most customers are generally satisfied with their purchases. Reviewers satisfied with Records Finder most frequently mention customer service, easy access, and accurate information. Records Finder ranks 3rd among Government Records sites.
This company responds to reviews on average within 2 days
I had cancelled online two days after starting the trial. It apparently didn't process my cancellation. Membership fee was drafted from my account. I called customer service expecting to be told they would cancel effective for today an no more drafts would occur. I was told that but upon expressing my disappointment the representative continue to reach out to his supervisor and I was given a credit for the amount withdrawn from my account.
I paid for the subscription try to obtain previous owner registration information or name from the title was unable to find any of the matching information after paying for the subscription
Luck of the draw
SOUNDED GOOD
Hello Joel,
Thank you for leaving us with such a wonderful rating. Our top priority is your experience and satisfaction, and your review reaffirms the hard work we put in every day. We look forward to assisting you again!
If there's anything that we can assist you further, please feel free to reach out to our support team through chat, email or call us at 1-800-433-0567.
Sincerely,
Christina
RecordsFinder.com
Customer Care Team
1-800-433-0567
Open 24 hours a day, 7 days a week
Hello Harvey,
Thank you for leaving us with such a wonderful rating. Our top priority is your experience and satisfaction, and your review reaffirms the hard work we put in every day. We look forward to assisting you again!
If there's anything that we can assist you further, please feel free to reach out to our support team through chat, email or call us at 1-800-433-0567.
Sincerely,
Christina
RecordsFinder.com
Customer Care Team
1-800-433-0567
Open 24 hours a day, 7 days a week
No help
Xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Hello Patricia,
I'm sorry to hear that you didn't find the assistance you were looking for. Your feedback is important to us, and we want to improve your experience. If you could provide more details about the issue or question you had, we would be happy to try and assist you better. Your input helps us make necessary improvements to our services. Thank you for bringing this to our attention.
Please reach out to us at askrecordsfinder@ask.recordsfinder.com or call us at 833-922-2315. We will be more than happy to assist.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Gooood gooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Hi Kenth,
We're happy you're pleased with the service. Have a fantastic day ahead, and stay safe!
Sincerely,
Lovely
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Anywayg gggggggbhhhhhhhhhhhhhhhtffftffffggggggggggggggggggggggggggggggggggggggggggggggggggggggghhĥhhhhhhhhhhhh
Hi Jeffrey,
Thank you for the five stars! We take it that you're satisfied with the service. We hope that you will also recommend us to others. Have a fantastic day ahead, and stay safe!
Sincerely,
Lovely
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Yeah hhhhhhgghgggggvbbbbgfsfsggdbbdbdhhdbfbbrbrbhrbrbrhbdgdhhdhdhdhfhhdhdhdhfhhdhdhdhfhdhdhgdhdhdhdhdhdhbdbdbdbdhdhdhdb
Hi Travis,
Thank you for taking the time to give us a review! We're happy you're satisfied with the service. We work hard to meet your expectations and are delighted we hit the mark for you.
If you need anything else, please do not hesitate to contact us at your most convenient time. Have a nice day ahead, and stay safe!
Sincerely,
Arden
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Okkkkkkkkkkkkkkkkkkkkkkkkkkkllklllkkkllllkkklllklllllkkkkkkkkkkkkķkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk
Hello Timothy,
Thank you for your review. We would love to hear more about your experience, and we can use your valuable feedback to deliver an even better experience next time!
Please get in touch with our Voice of Customer Team at askrecordsfinder@recordsfinder.com with any further comments or suggestions you wish to share.
Again, thank you for taking the time to review our business!
Sincerely,
Arden
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Didn't likehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
Hello Troy,
We appreciate your feedback and are sorry you were not satisfied with the report. We source our information from records made freely and publicly available by the state and local offices, agencies, and departments. Our data may contain errors and omissions due to legal state restrictions that are not in our control.
I would love to assist you and improve your experience. Please give us a call or send us an email at askrecordsfinder@ask.recordsfinder.com. We look forward to hearing from you! Have a great day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Behehrhendjsjdkskskskskskskjssjkskskskskskdjdjjddjjd
Hello Kristen,
Thank you for sharing your thoughts with us. It seems like there might be some unique insights in your feedback, but unfortunately, we're having difficulty interpreting the content. We strive to provide the best possible experience for our customers, and we value your input.
If there's anything specific you'd like to discuss or elaborate on, please feel free to provide more details. Your feedback is essential to us, and we want to ensure we address any concerns or comments you may have.
We appreciate your engagement and look forward to any additional information you might share.
Best regards,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Evevtebhrwyhwhtgwrsteshbrtdvftbrwynetntnbsrtbvshbgtujnebdfgbsvctyrhbsrdfvrsthb
Hello Angelo,
Thank you for sharing your feedback with us. We appreciate your input, but it seems that the content you provided is not clear or understandable. If you have specific concerns or comments you'd like us to address, please provide more details so that we can better assist you.
Thank you for your understanding.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Nanananananannanananananananannaanananananannanananana
Hello Nic,
Thank you for taking the time to provide feedback. However, it is a bit unclear. If you have specific thoughts, concerns, or suggestions, we would be more than happy to address them. Clear communication is essential for us to understand and respond effectively to your needs.
Please feel free to provide additional details or clarify your feedback so that we can better assist you.
Thank you for your understanding.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Ggjjccttfffyfcttffrrerhhfeegggrtgfewwfhiiydfvhfwwmhewfg
Hello Salvador,
It seems like you've provided a random sequence of letters and characters. Is there a specific question or topic you'd like me to address? Please provide more context, and I'll be happy to help. Please contact us at askrecordsfinder@ask.recordsfinder.com or call 833-922-2315. We look forward to hearing from you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Fjchchfhchdhdhdhdhdhdjxhf dhdjdhdbdndjxhdh ydjdjdjxhhddh
Hello Tong,
Thank you for your feedback. It appears there might be some technical issues or a misunderstanding. If you have any questions or concerns you'd like assistance with, please provide more details, and we'll be happy to help.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Kooolooiefjhhfhifjfkgijgkgifviciy hv. Jbuvhhhjn. Xdf. Llg
Hello Nicole,
Thank you for reaching out to us. However, it seems like the comment you provided appears to be a random string of characters and doesn't convey any specific message or query. If you have any questions or need assistance with anything, please feel free to share more details, and I'll be more than happy to help.
Looking forward to hearing from you soon!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Easy. Easy. Easy. Easy. Easy. Easy. Easy. Easy. Easy. Easy.
Hello Vatche,
Thank you for your positive feedback. We're delighted to hear that you found our product to be effortless. We continuously work to ensure a seamless user experience, and it's great to know that our efforts are paying off. If you have any further comments or suggestions, please feel free to share them with us. We value your input and are excited about the prospect of assisting you again down the road.
Sincerely,
Nina
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Got the job donezzzzzzzzzvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv
Hi John,
Thank you for taking the time to give us a review. We're happy you're satisfied with the service. We hope that you will also recommend us to others. Have a fantastic day ahead, and stay safe!
Sincerely,
Lovely
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Nannnbghfdghjfchurh hgkkfsfgkigg gdgjgzvnbgghukgxhitvjjrsg
Hi Amanda,
Thank you for the five stars! We take it that you're satisfied with the service. We hope that you will also recommend us to others. Have a fantastic day ahead, and stay safe!
Sincerely,
Lovely
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Midxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxccccxcccccfcccccc
Hi Thomas,
Thank you for your review. We would love to hear more about your experience, and we can use your valuable feedback to deliver an even better experience next time!
Please contact our Voice of Customer Team at askinfotracer@infotracer.com with any further comments or suggestions you wish to share.
Again, thank you for taking the time to review our business! Have a nice day ahead, and stay safe!
Sincerely,
Lovely
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Sucks! Sucks! Sucks! Sucks! Sucks! Sucks! Sucks! Sucks! Sucks! Sucks! Sucks! Sucks! Sucks! Sucks!
Hello Jihan,
We appreciate your feedback, and we're sorry to hear that you were not satisfied with the report you received. We want to turn things around and assist you in getting the information you need.
If you wish, we can schedule a call the soonest you are free, or you can reach out to us via email at askinfotracer@infotracer.com. Rest assured, we're here to help you.
We look forward to hearing from you. Have a great day ahead, and stay safe!
Sincerely,
Lovely
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Hi Daniel,
We sincerely apologize if the information you received was not updated. Our reports may not always be 100% up-to-date, accurate or complete since data is pulled from records maintained by various state, county, municipal, and other agencies. Many others are only partially digitized. Records may exist that cannot be accessed digitally.
Moreover, all materials and information available are provided "as is" and "as available," without warranties of any kind, either expressed or implied, and specifically including the warranties of merchantability and fitness for a particular purpose. Rest assured, we will be improving our services in the future. If you need further assistance, please let us know.
Have a nice day ahead, and stay safe!
Sincerely,
Lovely
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Ok*******555**************dhhdyshshsgshsyshshhsudhshsyshshsgsshshshhsnsjxbhdubwhd
Hello Maurizio,
Thank you for taking the time to share your feedback. However, the review you provided seems difficult to interpret. We apologize if there was any confusion or if there was an issue you wanted to address.
If you have any specific concerns or inquiries related to our services, please feel free to provide more information, and we would be happy to assist you. You may reach out to us via email at askrecordsfinder@ask.recordsfinder.com or call us at (833) 922-2315. Your satisfaction is important to us, and we strive to ensure a positive experience for all our customers.
We appreciate your feedback and look forward to hearing from you with further details.
Sincerely,
Nina
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Gggggggghhhhhgggggggggggggggggggggdssssssiooiiiiivvv
Hello Abdoulaye,
We’re sorry to hear about your experience. We’re sorry your experience didn’t match your expectations. It was an uncommon instance, and we’ll do better in the future.
Please get in touch with us at askrecordsfinder@recordsfinder.com with any further comments, concerns, or suggestions you wish to share. We would love to make things right if you give us another chance.
We look forward to hearing from you. Have a great day ahead, and stay safe!
Sincerely,
Arden
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
JhhhvmmdnenejejdjejdjdjdjdjdjejejejdhevevbBhbhvvhhhhv bbvhvvh bbjbhhhjjj Hjhhjkkc
Hello Ashley,
We see your rating and want to know how we can assist you best. We look forward to hearing about your experience.
For your questions, comments, or suggestions, pls feel free to reach us at askrecordsfinder@recordsfinder.com at your most convenient time.
We look forward to hearing from you. Have a great day ahead.
Sincerely,
Eddy
Customer Relations Officer
+1 833-922-2315
www.recordsfinder.com
I had a Jaqueli*******Jaqueli*******
Jaqueli*******
Hello HhOrder,
Thank you for your review. We would love to hear more about your experience, and we can use your valuable feedback to deliver an even better experience. Please get in touch with our Voice of Customer Team at askrecordsfinder@recordsfinder.com with any further comments or suggestions you wish to share.
Again, thank you for taking the time to review our business!
Sincerely,
Arden
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Gain trust and grow your business with customer reviews.
Access over 2 billion public records from thousands of federal, state, city and municipal sources
Hello Marc,
Thank you for leaving us with such an excellent rating. Our top priority is your experience and satisfaction, and your review reaffirms the hard work we put in every day. We look forward to assisting you again!
If there's anything that we can assist you further, please feel free to reach out to our support team through chat, email, or call us at 1-800-433-0567.
Sincerely,
Christina
RecordsFinder.com
Customer Care Team
1-800-433-0567
Open 24 hours a day, seven days a week